thenewsfacts.com
  • Home
  • Latest News
  • Trending News
  • Technology
  • entertainment
  • Sports
  • Business
thenewsfacts.comthenewsfacts.com
Font ResizerAa
Search
  • Home
  • Latest News
  • Trending News
  • Technology
  • entertainment
  • Sports
  • Business
Follow US
© thenewsfacts : All Rights Reserved.

Home » Bhaijaan Salman Khan, Lady Superstar Nayanthara kick off SVC63

Entertainment

Bhaijaan Salman Khan, Lady Superstar Nayanthara kick off SVC63

NewsFacts Bureau
Last updated: April 19, 2026 6:09 pm
NewsFacts Bureau
Share
Salman khan Nayantara
Bhaijaan Salman Khan, Lady Superstar Nayanthara kick off SVC63
SHARE

Sunday, April 19, 2026: The wait is finally over for fans of Salman Khan and the Lady Superstar. In what can only be described as a tectonic shift for the Indian film industry, the massive collaboration between Salman Khan, National Award-winning director Vamshi Paidipally, and powerhouse producer Dil Raju has officially hit the floors in Mumbai.

Adding fuel to an already blazing fire of anticipation, Nayanthara has joined the cast as the leading lady, marking her first-ever onscreen pairing with Salman Khan. This fresh duo is expected to be the beating heart of the project, tentatively titled #SVC63.

#SVC63: Salman Khan-Nayanthara Actioner Goes on Floors with a Massive Mumbai Schedule

#SALMANKHANVAMSHIPAIDIPALLYFILM… IT ALL BEGINS TODAY.. ❤️🔥#Nayanthara #SVC63 @SVC_official pic.twitter.com/Ei1NVTnQb6

— Vamshi Paidipally (@directorvamshi) April 18, 2026

The film was set in motion with a traditional and intimate muhurtham ceremony, after which the crew wasted no time, heading straight into a rigorous month-long schedule.

Our sources tell us that a mammoth, high-budget set has been erected in Mumbai specifically for this phase. The team is currently canning high-octane action blocks and pivotal dramatic sequences that require a grand scale. Vamshi Paidipally, known for blending family emotions with commercial gloss (as seen in Maharshi and Varisu), is reportedly crafting a “performance-heavy” role for Nayanthara that goes beyond the typical commercial heroine template.

This project marks a series of “firsts” that have the trade circuit buzzing:

Happy to Welcome #NAYANTHARA on board #SalmanKhanVamshiPaidipallyFilm.

Always admired Her for the Grace, Strength and the Dignity that She always carries.

Super Excited for what we are about to create.. 😊😊#DilRaju #Shirish
@svc_offical @kuldeeprathor9 #RafiKazi… pic.twitter.com/j8HrUONiu5

— Vamshi Paidipally (@directorvamshi) March 31, 2026
  • Salman x Vamshi: A blend of Bollywood’s raw stardom and Tollywood’s emotional storytelling.
  • Salman x Dil Raju: The legendary producer (Sri Venkateswara Creations) is making a massive splash in the Hindi market with this venture.
  • The Lead Pair: Nayanthara and Salman’s chemistry is being touted as the film’s biggest USP.

Vamshi Paidipally took to social media to signal the start of this journey, sharing his excitement about bringing this ambitious vision to life. While the film is being mounted as a large-scale action drama, insiders suggest there is a deep emotional core that will resonate across all language markets.

With the cameras now rolling, the makers are eyeing a grand theatrical release in 2027. While the rest of the supporting cast and the technical crew remain under wraps for now, the sheer scale of the Mumbai schedule suggests that Dil Raju is leaving no stone unturned to make this a cinematic event for the ages.

This is certainly one of the biggest pan-Indian projects currently in production. Would you like me to focus more on the potential plot theories for this collaboration, or perhaps a deeper dive into the track record of Sri Venkateswara Creations in big-budget cinema?

TAGGED:2027 ReleaseBollywood newsDil RajuMumbai ScheduleNayantharaSalman KhanSouth CinemaSVC63Vamshi Paidipally
Share This Article
Email Copy Link Print
Previous Article SEBI NEW LISTIING RULES SEBI’s Bold New Rule to Save Listings from Market Turmoil
Next Article Whatsapp Plus The $2.35 Chat: Why Meta Wants You to Pay for WhatsApp

Your Trusted Source for Accurate and Timely Updates!

We're committed to providing accurate and unbiased news as it unfolds, earning the trust of a large audience. Stay informed with our news updates on the latest events and trends, keeping you ahead of the curve.
FacebookLike
XFollow
InstagramFollow

Popular Posts

Online ‘Astronaut’ Tricks Hokkaido Woman, Steals ₹6L

September 5, 2025: In a concerning case of online deception, an 80-year-old woman from Hokkaido,…

By
NewsFacts Bureau

Children’s Day: From Playgrounds to Progress, This Day Reinforces Rights and Joy

Today is Children's Day. In a kaleidoscope of vibrant festivities and heartfelt initiatives, the world…

By
TheNewsFacts

High Protein Diets May Increase Heart Attack Risk, Study Finds

Feb 20: A recent report published in Nature has shed light on the potential risks…

By
SK Panicker

You Might Also Like

Raja Shivaji Review
Entertainment

Raja Shivaji: A Blend of Valor, Vision, and Visual Grandeur

By
SK Panicker
Entertainment

L2E – Empuraan: Mohanlal’s Sequel Set to Dominate Box Office

By
TheNewsFacts
"Be a Real Hero" Madras High Court tells Actor Vijay
Entertainment

“Be a Real Hero” Madras High Court tells Actor Vijay

By
TheNewsFacts
Entertainment

Guntur Kaaram: A Sankranti Treat with a Struggle for Identity

By
TheNewsFacts
thenewsfacts thenewsfacts

About US


TheNewsFacts: Brings you the interesting facts, news facts and updates from India an the world across politics, tech, entertainment, business, tending, and more. We deliver what you love to read.
Top Categories
  • Latest News
  • Trending News
  • Paris Olympics 2024
  • Sports
  • Entertainment
  • Business
  • Technology
Usefull Links
  • About The News Facts
  • Latest News
  • Privacy Policy
  • Editorial Policy
  • Disclaimer
  • Contact Us
Follow us
Facebook Twitter Instagram

© thenewsfacts. All Rights Reserved.

Welcome Back!

Sign in to your account

Username or Email Address
Password

Lost your password?